PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR01G04110.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family MYB
Protein Properties Length: 277aa    MW: 29505.9 Da    PI: 4.7617
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR01G04110.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding378e-123175148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W++eEde+l+  +++ G  tW++    +g++R++k+c++rw +yl
  LPERR01G04110.1 31 KGLWSPEEDERLYTHITRCGVSTWSS---VIGLRRSGKSCRLRWMNYL 75
                     678***********************...789999***********97 PP

2Myb_DNA-binding42.21.9e-1383123345
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      + T  E e ++ + k+lG++ W+ Ia++m+ gRt++++k++w+
  LPERR01G04110.1  83 PITDREAETIISLQKLLGNR-WSVIAAKMP-GRTDNEIKNYWN 123
                      67999***************.*********.***********9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129410.9192675IPR017930Myb domain
SMARTSM007173.3E-63077IPR001005SANT/Myb domain
SuperFamilySSF466893.23E-2530122IPR009057Homeodomain-like
PfamPF002491.3E-93175IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.1E-173282IPR009057Homeodomain-like
CDDcd001671.57E-73475No hitNo description
PROSITE profilePS5129420.99476130IPR017930Myb domain
SMARTSM007171.9E-1280128IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.5E-2283129IPR009057Homeodomain-like
CDDcd001671.77E-983123No hitNo description
PfamPF002495.5E-1183124IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 277 aa     Download sequence    Send to blast
MVRKPITSRH GEAAAAVNAG DMAAAEERER KGLWSPEEDE RLYTHITRCG VSTWSSVIGL  60
RRSGKSCRLR WMNYLRPDLK KEPITDREAE TIISLQKLLG NRWSVIAAKM PGRTDNEIKN  120
YWNSRIRKRQ TAAAAVAESR AKTEPPALAA GDEPCADAAA VEATAAAPSS PPPIAARLPV  180
FACQLLDGGA VAATQSSPTA TEQLVNGAGS SESEASAGGN GGGGEDYSYS GGGVDGDMVR  240
HLLALDDLDL LIDVPGLLDS WECELYYPED SSSSMSN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C5e-243112927127MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015694952.11e-117PREDICTED: myb-related protein Hv33-like
TrEMBLA0A0D9UX860.0A0A0D9UX86_9ORYZ; Uncharacterized protein
STRINGSi002595m5e-85(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP87032545
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G09540.17e-41myb domain protein 61